SECTM1 Rabbit Polyclonal Antibody

• Catalog Number: orb325214
• Category: Antibodies
• Description: Rabbit polyclonal antibody to SECTM1
• Target: SECTM1
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Human
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SECTM1
• Protein Sequence: Synthetic peptide located within the following region: ARDSHAGLYMWHLVGHQRNNRQVTLEVSGAEPQSAPDTGFWPVPAVVTAV
• UniProt ID: Q8WVN6
• MW: 27 kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: anti K12 antibody
• Research Area: Cell Biology
• Note: For research use only
• NCBI: NP_002995

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/mL of the antibody was used in this experiment Protein is processed to 24 kDa and may further be glycosylated.

WB Suggested Anti-SECTM1 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:1562500, Positive Control: RPMI 8226 cell lysate.