You have no items in your shopping cart.
Cart summary
Item 1 of 2
Item 1 of 2
SECTM1 Rabbit Polyclonal Antibody
Catalog Number: orb325214
| Catalog Number | orb325214 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to SECTM1 |
| Species/Host | Rabbit |
| Clonality | Polyclonal |
| Tested applications | WB |
| Predicted Reactivity | Human |
| Reactivity | Human |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human SECTM1 |
| Concentration | 0.5 mg/ml |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Conjugation | Unconjugated |
| MW | 27 kDa |
| Target | SECTM1 |
| UniProt ID | Q8WVN6 |
| Protein Sequence | Synthetic peptide located within the following region: ARDSHAGLYMWHLVGHQRNNRQVTLEVSGAEPQSAPDTGFWPVPAVVTAV |
| NCBI | NP_002995 |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Alternative names | anti K12 antibody Read more... |
| Note | For research use only |
| Expiration Date | 12 months from date of receipt. |
25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/mL of the antibody was used in this experiment Protein is processed to 24 kDa and may further be glycosylated.
WB Suggested Anti-SECTM1 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:1562500, Positive Control: RPMI 8226 cell lysate.
- Item 1 of 4
SECTM1 Rabbit Polyclonal Antibody [orb500584]
IF, IHC-Fr, IHC-P
Human
Rat
Rabbit
Polyclonal
Unconjugated
50 μl, 100 μl, 200 μl - Item 1 of 1
