SEC23IP Rabbit Polyclonal Antibody

SKU: orb581653

Description

Rabbit polyclonal antibody to SEC23IP

Research Area

Cell Biology

Images & Validation

• Tested Applications: WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SEC23IP
• Target: SEC23IP
• Protein Sequence: Synthetic peptide located within the following region: VPFIPVTQASASPASLLLPGEDSTDVGEEDSFLGQTSIHTSAPQTFSYFS
• Molecular Weight: 111kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

P125, P125A, MSTP053, iPLA1beta

Sample Tissue: Human THP-1 Whole Cell, Antibody dilution: 1 ug/ml.

WB Suggested Anti-SEC23IP Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: HepG2 cell lysate. SEC23IP is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells.

Quick Database Links

Gene Symbol

SEC23IP

UniProt

Q9Y6Y8

RefSeq (Protein):NP_009121