You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb581653 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to SEC23IP |
Target | SEC23IP |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human SEC23IP |
Protein Sequence | Synthetic peptide located within the following region: VPFIPVTQASASPASLLLPGEDSTDVGEEDSFLGQTSIHTSAPQTFSYFS |
UniProt ID | Q9Y6Y8 |
MW | 111kDa |
Tested applications | WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | P125, P125A, MSTP053, iPLA1beta |
Note | For research use only |
NCBI | NP_009121 |
Sample Tissue: Human THP-1 Whole Cell, Antibody dilution: 1 ug/ml.
WB Suggested Anti-SEC23IP Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: HepG2 cell lysate. SEC23IP is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells.
ELISA, IF, IHC, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
ICC, IF, IHC-Fr, IHC-P | |
Bovine, Equine, Human, Mouse | |
Rabbit, Rat, Sheep | |
Rabbit | |
Polyclonal | |
Biotin |