Cart summary

You have no items in your shopping cart.

Sec14l3 Rabbit Polyclonal Antibody (FITC)

Sec14l3 Rabbit Polyclonal Antibody (FITC)

Catalog Number: orb2104599

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2104599
CategoryAntibodies
DescriptionSec14l3 Rabbit Polyclonal Antibody (FITC)
Species/HostRabbit
ClonalityPolyclonal
Tested applicationsWB
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat
ImmunogenThe immunogen is a synthetic peptide corresponding to a region of Rat
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
ConjugationFITC
MW44kDa
UniProt IDQ9Z1J8
Protein SequenceSynthetic peptide located within the following region: RDQVKTQYEHSVQISRGSSHQVEYEILFPGCVLRWQFSSDGADIGFGVFL
NCBINP_072130
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
Alternative namesSpf2
Read more...
NoteFor research use only
Expiration Date12 months from date of receipt.