Cart summary

You have no items in your shopping cart.

SCAPER Rabbit Polyclonal Antibody (Biotin)

SCAPER Rabbit Polyclonal Antibody (Biotin)

Catalog Number: orb2127412

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2127412
CategoryAntibodies
DescriptionSCAPER Rabbit Polyclonal Antibody (Biotin)
ClonalityPolyclonal
Species/HostRabbit
ConjugationBiotin
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human SCAPER
Protein SequenceSynthetic peptide located within the following region: MMASFQRSNSHDKVRRIVAEEGRTARNLIAWSVPLESKDDDGKPKCQTGG
UniProt IDQ9BY12
MW158kDa
Tested applicationsWB
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Alternative namesIDDRP, ZNF291, Zfp291, MSTP063
NoteFor research use only
NCBINP_065894
  • SCAPER Rabbit Polyclonal Antibody (Biotin) [orb450738]

    ELISA,  ICC,  IF,  IHC-Fr,  IHC-P

    Bovine, Canine, Equine, Gallus, Human, Mouse, Porcine, Rabbit, Rat, Sheep

    Rabbit

    Polyclonal

    Biotin

    100 μl