SAP18 Rabbit Polyclonal Antibody

• Catalog Number: orb576792
• Category: Antibodies
• Description: Rabbit polyclonal antibody to SAP18
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SAP18
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 18kDa
• Target: SAP18
• UniProt ID: O00422
• Protein Sequence: Synthetic peptide located within the following region: EIKKEPEKPIDREKTCPLLLRVFTTNNGRHHRMDEFSRGNVPSSELQIYT
• NCBI: NP_005861
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: SAP18P, 2HOR0202
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Rabbit Anti-SAP18 Antibody, Catalog Number: orb576792, Formalin Fixed Paraffin Embedded Tissue: Human Testis Tissue, Observed Staining: Cytoplasm in spermatogonia and spermatocytes, Primary Antibody Concentration: N/A, Other Working Concentrations: 1:600, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

WB Suggested Anti-SAP18 Antibody Titration: 0.125 ug/ml, ELISA Titer: 1:312500, Positive Control: Transfected 293T.