You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb330726 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to SAMD4A |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Animal, Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish |
Reactivity | Canine, Equine, Guinea pig, Human, Mouse, Rat, Zebrafish |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human SAMD4A |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 79kDa |
Target | SAMD4A |
UniProt ID | Q9UPU9 |
Protein Sequence | Synthetic peptide located within the following region: LKSLRLHKYAALFSQMTYEEMMALTECQLEAQNVTKGARHKIVISIQKLK |
NCBI | NP_056404 |
Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -2°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | anti DKFZp434H0350 antibody, anti KIAA1053 antibod Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Western blot analysis of human Liver tissue using SAMD4A antibody
Western blot analysis of human Fetal Brain tissue using SAMD4A antibody
Western blot analysis of human Fetal Liver tissue using SAMD4A antibody
Filter by Rating