SAMD4A Rabbit Polyclonal Antibody

SKU: orb330726

Description

SAMD4A Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of SAMD4A. It is suitable for WB application. The immunogen is a synthetic peptide directed towards the middle region of human SAMD4A. This antibody reacts with Human samples and is predicted to react with Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Molecular Biology

Images & Validation

• Tested Applications: WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SAMD4A
• Target: SAMD4A
• Protein Sequence: Synthetic peptide located within the following region: LKSLRLHKYAALFSQMTYEEMMALTECQLEAQNVTKGARHKIVISIQKLK
• Molecular Weight: 79kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

anti DKFZp434H0350 antibody, anti KIAA1053 antibody, anti SAMD4 antibody, anti SMG antibody, anti SMGA antibody, anti Smaug antibody, anti Smaug1 antibody, anti SMAUG antibody, anti SMAUG1 antibody

Quick Database Links

Gene Symbol

SAMD4A

UniProt

Q9UPU9

RefSeq (Protein):NP_056404