You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb325692 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to SAMD15 |
Target | SAMD15 |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Equine, Yeast |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human C14orf174 |
Protein Sequence | Synthetic peptide located within the following region: FPSEKLGESLEETDLQPPKMTKPETPEETQRESTEKKRTEPPEQARLEFL |
UniProt ID | Q9P1V8 |
MW | 77kDa |
Tested applications | WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | anti FAM15A antibody, anti FLJ35963 antibody, anti Read more... |
Note | For research use only |
NCBI | NP_001010860 |
WB Suggested Anti-C14orf174 Antibody Titration: 0.2-1 ug/mL, Positive Control: HepG2 cell lysate.
IF, IHC-Fr, IHC-P | |
Bovine, Canine, Human, Mouse, Rabbit, Sheep | |
Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, ICC, IF, IHC-Fr, IHC-P | |
Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IHC-Fr, IHC-P | |
Bovine, Canine, Human, Mouse, Rabbit, Sheep | |
Rat | |
Rabbit | |
Polyclonal | |
AP |
IF | |
Bovine, Canine, Human, Mouse, Rabbit, Sheep | |
Rat | |
Rabbit | |
Polyclonal | |
Cy5 |