You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb578557 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to EDG8 |
Target | S1PR5 |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Bovine, Canine, Mouse, Porcine, Rat |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 1.0 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human EDG8 |
Protein Sequence | Synthetic peptide located within the following region: MESGLLRPAPVSEVIVLHYNYTGKLRGARYQPGAGLRADAVVCLAVCAFI |
UniProt ID | Q9H228 |
MW | 16kDa |
Tested applications | IHC, WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | EDG8, S1P5, Edg-8, SPPR-1, SPPR-2 |
Note | For research use only |
NCBI | EAW84115 |
Human Intestine
WB Suggested Anti-EDG8 Antibody Titration: 2.5 ug/ml, Positive Control: Jurkat cell lysate.
IF, IHC-Fr, IHC-P | |
Canine, Human, Mouse, Porcine | |
Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IHC, WB | |
Bovine, Canine, Mouse, Porcine, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, ICC, IF, IHC-Fr, IHC-P | |
Porcine, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |