EDG8 Rabbit Polyclonal Antibody

• Catalog Number: orb578557
• Category: Antibodies
• Description: Rabbit polyclonal antibody to EDG8
• Target: S1PR5
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Mouse, Porcine, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 1.0 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human EDG8
• Protein Sequence: Synthetic peptide located within the following region: MESGLLRPAPVSEVIVLHYNYTGKLRGARYQPGAGLRADAVVCLAVCAFI
• UniProt ID: Q9H228
• MW: 16kDa
• Tested applications: IHC, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: EDG8, S1P5, Edg-8, SPPR-1, SPPR-2
• Note: For research use only
• NCBI: EAW84115

Human Intestine

WB Suggested Anti-EDG8 Antibody Titration: 2.5 ug/ml, Positive Control: Jurkat cell lysate.