S100A3 Rabbit Polyclonal Antibody

• Catalog Number: orb578328
• Category: Antibodies
• Description: Rabbit polyclonal antibody to S100A3
• Target: S100A3
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 1.0 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human S100A3
• Protein Sequence: Synthetic peptide located within the following region: MARPLEQAVAAIVCTFQEYAGRCGDKYKLCQAELKELLQKELATWTPTEF
• UniProt ID: P33764
• MW: 11kDa
• Tested applications: IHC, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: S100E
• Note: For research use only
• NCBI: NP_002951

Positive control (+): HepG2 (HG), Negative control (-): THP-1 (N30), Antibody concentration: 3 ug/ml.

Rabbit Anti-S100A3 Antibody, Paraffin Embedded Tissue: Human Skin, Cellular Data: Squamous epithelial cells, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.

WB Suggested Anti-S100A3 Antibody Titration: 5.0 ug/ml, Positive Control: OVCAR-3 cell lysate. S100A3 is supported by BioGPS gene expression data to be expressed in OVCAR3.