You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb576915 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to RYBP |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human RYBP |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 25kDa |
Target | RYBP |
UniProt ID | Q8N488 |
Protein Sequence | Synthetic peptide located within the following region: STSSSTVTSSAGSEQQNQSSSGSESTDKGSSRSSTPKGDMSAVNDESF |
NCBI | NP_036366 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | AAP1, DEDAF, YEAF1, APAP-1 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Lanes: 1. 50 ug 38B9 cell lysate, 2. 50 ug CH12 cell lysate, 3. 50 ug HeLa cell lysate, 4. Purified RYBP Protein, Primary Antibody Dilution: 1:1000, Secondary Antibody: Anti-Rabbit HRP, Secondary Antibody Dilution: 1:30000, Gene Name: RYBP.
WB Suggested Anti-RYBP Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: Human Muscle.
IHC, WB | |
Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
IHC, WB | |
Bovine, Mouse, Zebrafish | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, IHC-Fr, IHC-P | |
Bovine, Canine, Equine, Gallus, Rat | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |