Cart summary

You have no items in your shopping cart.

RXRA Rabbit Polyclonal Antibody

SKU: orb330317

Description

Rabbit polyclonal antibody to RXRA

Research Area

Epigenetics & Chromatin, Molecular Biology, Stem Cell & Developmental Biology

Images & Validation

Tested ApplicationsWB
ReactivityHuman
Predicted ReactivityBovine, Canine, Guinea pig, Mouse, Rat

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human RXRA
TargetRXRA
Protein SequenceSynthetic peptide located within the following region: DTKHFLPLDFSTQVNSSLTSPTGRGSMAAPSLHPSLGPGIGSPGQLHSPI
Molecular Weight51kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

anti FLJ16020 antibody, anti FLJ16733 antibody, anti MGC102720 antibody, anti NR2B1 antibody

Similar Products

  • RXRA Rabbit Polyclonal Antibody [orb329759]

    WB

    Bovine, Canine, Equine, Guinea pig, Mouse

    Human, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μl
  • Retinoid X Receptor alpha/RXRA Rabbit Polyclonal Antibody [orb402244]

    ELISA,  FC,  ICC,  IF,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
  • RXRA Rabbit Polyclonal Antibody [orb630909]

    ELISA,  IF,  IHC,  IP,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μg, 100 μg
  • Retinoid X receptor alpha Rabbit Polyclonal Antibody [orb499621]

    FC,  IF,  IHC-Fr,  IHC-P,  WB

    Canine, Equine, Gallus, Mouse

    Human, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • Retinoid X receptor alpha Rabbit Polyclonal Antibody [orb11341]

    FC,  IF,  IHC-Fr,  IHC-P

    Canine, Gallus, Guinea pig, Mouse, Porcine

    Human, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

RXRA Rabbit Polyclonal Antibody

Sample Type: Human Fetal Heart, Antibody Dilution: 1.0 ug/mL.

RXRA Rabbit Polyclonal Antibody

Sample Type: Human Fetal Liver, Antibody Dilution: 1.0 ug/mL.

RXRA Rabbit Polyclonal Antibody

Sample Type: Human Fetal Lung, Antibody Dilution: 1.0 ug/mL.

RXRA Rabbit Polyclonal Antibody

Sample Type: Human Fetal Muscle, Antibody Dilution: 1.0 ug/mL.

RXRA Rabbit Polyclonal Antibody

Sample Type: Human MCF7, Antibody Dilution: 1.0 ug/mL, RXRA is strongly supported by BioGPS gene expression data to be expressed in MCF7.

RXRA Rabbit Polyclonal Antibody

WB Suggested Anti-RXRA Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:312500, Positive Control: HepG2 cell lysate, RXRA is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_002948

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

RXRA Rabbit Polyclonal Antibody (orb330317)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 600.00
DispatchUsually dispatched within 1 - 2 weeks
Bulk Enquiry