RXRA Rabbit Polyclonal Antibody

• Catalog Number: orb330317
• Category: Antibodies
• Description: Rabbit polyclonal antibody to RXRA
• Target: RXRA
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Guinea pig, Mouse, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human RXRA
• Protein Sequence: Synthetic peptide located within the following region: DTKHFLPLDFSTQVNSSLTSPTGRGSMAAPSLHPSLGPGIGSPGQLHSPI
• UniProt ID: P19793
• MW: 51kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: anti FLJ16020 antibody, anti FLJ16733 antibody, an
• Note: For research use only
• NCBI: NP_002948

Sample Type: Human Fetal Heart, Antibody Dilution: 1.0 ug/mL.

Sample Type: Human Fetal Liver, Antibody Dilution: 1.0 ug/mL.

Sample Type: Human Fetal Lung, Antibody Dilution: 1.0 ug/mL.

Sample Type: Human Fetal Muscle, Antibody Dilution: 1.0 ug/mL.

Sample Type: Human MCF7, Antibody Dilution: 1.0 ug/mL, RXRA is strongly supported by BioGPS gene expression data to be expressed in MCF7.

WB Suggested Anti-RXRA Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:312500, Positive Control: HepG2 cell lysate, RXRA is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells.