You have no items in your shopping cart.
Cart summary
Item 1 of 1
RUBCNL Rabbit Polyclonal Antibody
Catalog Number: orb326434
| Catalog Number | orb326434 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to KIAA0226L |
| Species/Host | Rabbit |
| Clonality | Polyclonal |
| Tested applications | WB |
| Predicted Reactivity | Bovine, Equine |
| Reactivity | Human |
| Concentration | 0.5 mg/ml |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Conjugation | Unconjugated |
| MW | 70kDa |
| Target | RUBCNL |
| UniProt ID | Q96CS2 |
| Protein Sequence | Synthetic peptide located within the following region: SKEVSGLLGSDQPDSEMTFDTNIKQESGSSTSSYSGYEGCAVLQVSPVTE |
| NCBI | NP_612452 |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Alternative names | anti FLJ21562 antibody, anti FLJ43762 antibody, an Read more... |
| Note | For research use only |
| Expiration Date | 12 months from date of receipt. |
WB Suggested Anti-KIAA0226L Antibody, Titration: 1.0 ug/mL, Positive Control: Jurkat Whole Cell, KIAA0226L is supported by BioGPS gene expression data to be expressed in Jurkat.
- Item 1 of 2
- Item 1 of 2
- Item 1 of 1
- Item 1 of 1
RUBCNL Rabbit Polyclonal Antibody (HRP) [orb2094695]
WB
Bovine, Equine, Human
Rabbit
Polyclonal
HRP
100 μl
