You have no items in your shopping cart.
You have no items in your shopping cart.
| Catalog Number | orb326434 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to KIAA0226L |
| Target | RUBCNL |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Human |
| Predicted Reactivity | Bovine, Equine |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Affinity Purified |
| Protein Sequence | Synthetic peptide located within the following region: SKEVSGLLGSDQPDSEMTFDTNIKQESGSSTSSYSGYEGCAVLQVSPVTE |
| UniProt ID | Q96CS2 |
| MW | 70kDa |
| Tested applications | WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Alternative names | anti FLJ21562 antibody, anti FLJ43762 antibody, an Read more... |
| Note | For research use only |
| NCBI | NP_612452 |

WB Suggested Anti-KIAA0226L Antibody, Titration: 1.0 ug/mL, Positive Control: Jurkat Whole Cell, KIAA0226L is supported by BioGPS gene expression data to be expressed in Jurkat.
WB | |
Bovine, Equine, Human | |
Rabbit | |
Polyclonal | |
Biotin |
WB | |
Bovine, Equine, Human | |
Rabbit | |
Polyclonal | |
FITC |
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review