Cart summary

You have no items in your shopping cart.

RTP4 Rabbit Polyclonal Antibody (FITC)

RTP4 Rabbit Polyclonal Antibody (FITC)

Catalog Number: orb2101365

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2101365
CategoryAntibodies
DescriptionRTP4 Rabbit Polyclonal Antibody (FITC)
Species/HostRabbit
ClonalityPolyclonal
Tested applicationsWB
Predicted ReactivityHuman
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human RTP4
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
ConjugationFITC
MW28kDa
UniProt IDQ96DX8
Protein SequenceSynthetic peptide located within the following region: SSDSTMRILSNLVQHILKKYYGNGTRKSPEMPVILEVSLEGSHDTANCEA
NCBINP_071430
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
Alternative namesIFRG28, Z3CXXC4
Read more...
NoteFor research use only
Expiration Date12 months from date of receipt.