You have no items in your shopping cart.
RSAD1 Rabbit Polyclonal Antibody
Description
Research Area
Images & Validation
−| Tested Applications | WB |
|---|---|
| Reactivity | Human |
| Predicted Reactivity | Bovine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish |
Key Properties
−| Host | Rabbit |
|---|---|
| Clonality | Polyclonal |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human RSAD1 |
| Target | RSAD1 |
| Protein Sequence | Synthetic peptide located within the following region: NWTYWQCGQYLGVGPGAHGRFMPQGAGGHTREARIQTLEPDNWMKEVMLF |
| Molecular Weight | 49kDa |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−RSAD1 rabbit pAb Antibody [orb766270]
ELISA, IF, IHC, WB
Human, Mouse
Polyclonal
Unconjugated
100 μl, 50 μl

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

WB Suggested Anti-RSAD1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: 293T cell lysate. RSAD1 is supported by BioGPS gene expression data to be expressed in HEK293T.
Documents Download
Request a Document
RSAD1 Rabbit Polyclonal Antibody (orb583489)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review









