You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb575096 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to RRN3 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Yeast |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human RRN3 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 74kDa |
Target | RRN3 |
UniProt ID | Q9NYV6 |
Protein Sequence | Synthetic peptide located within the following region: KKDIVEDEDDDFLKGEVPQNDTVIGITPSSFDTHFRSPSSSVGSPPVLYM |
NCBI | NP_060897 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | TIFIA, A-270G1.2 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Sample Tissue: Human PANC1 Whole Cell, Antibody dilution: 0.5 ug/ml.
WB Suggested Anti-RRN3 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: Jurkat cell lysate, RRN3 is supported by BioGPS gene expression data to be expressed in Jurkat.
ELISA, IHC-P, WB | |
Human, Mouse, Rat | |
Polyclonal | |
Unconjugated |
IH, WB | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |