RPSA Rabbit Polyclonal Antibody

• Catalog Number: orb330770
• Category: Antibodies
• Description: Rabbit polyclonal antibody to RPSA
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Goat, Guinea pig, Mouse, Rabbit, Rat, Sheep, Zebrafish
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RPSA
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 33kDa
• Target: RPSA
• UniProt ID: P08865
• Protein Sequence: Synthetic peptide located within the following region: TFTNQIQAAFREPRLLVVTDPRADHQPLTEASYVNLPTIALCNTDSPLRY
• NCBI: NP_002286
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti 37LRP antibody, anti 67LR antibody, anti LAMB
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Immunohistochemistry with Spleen tissue at an antibody concentration of 5 ug/ml using anti-RPSA antibody (orb330770).

WB Suggested Anti-RPSA Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: Human Thymus.

WB Suggested Anti-RPSA Antibody Titration: 1 ug/ml, Positive Control: Human Kidney.