RPSA Rabbit Polyclonal Antibody

SKU: orb330770

Description

Rabbit polyclonal antibody to RPSA

Research Area

Cell Biology, Epigenetics & Chromatin, Molecular Biology

Images & Validation

• Tested Applications: IHC, WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Goat, Guinea pig, Mouse, Rabbit, Rat, Sheep, Zebrafish

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RPSA
• Target: RPSA
• Protein Sequence: Synthetic peptide located within the following region: TFTNQIQAAFREPRLLVVTDPRADHQPLTEASYVNLPTIALCNTDSPLRY
• Molecular Weight: 33kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

anti 37LRP antibody, anti 67LR antibody, anti LAMBR antibody, anti LAMR1 antibody, anti LRP antibody, anti p40 antibody, anti SA antibody, anti LBP antibody, anti lamR antibody, anti LRP/LR antibody, anti LBP/p40 antibody, anti NEM/1CHD4 antibody

Immunohistochemistry with Spleen tissue at an antibody concentration of 5 ug/ml using anti-RPSA antibody (orb330770).

WB Suggested Anti-RPSA Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: Human Thymus.

WB Suggested Anti-RPSA Antibody Titration: 1 ug/ml, Positive Control: Human Kidney.

Quick Database Links

Gene Symbol

RPSA

UniProt

P08865

RefSeq (Protein):NP_002286