You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb577534 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to RPS14 |
Target | RPS14 |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Yeast, Zebrafish |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 1.0 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human RPS14 |
Protein Sequence | Synthetic peptide located within the following region: GNRTKTPGPGAQSALRALARSGMKIGRIEDVTPIPSDSTRRKGGRRGRRL |
UniProt ID | P62263 |
MW | 17kDa |
Tested applications | WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | S14, EMTB |
Note | For research use only |
NCBI | NP_001020242 |
Sample Type: 721_B, Antibody Dilution: 1.0 ug/ml. RPS14 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells.
Sample Type: Hela, Antibody Dilution: 1.0 ug/ml. RPS14 is supported by BioGPS gene expression data to be expressed in HeLa.
Sample Type: Human Fetal Brain, Antibody Dilution: 1.0 ug/ml.
Sample Type: Human Fetal Liver, Antibody Dilution: 1.0 ug/ml.
Sample Type: Human Fetal Lung, Antibody Dilution: 1.0 ug/ml.
Sample Type: Jurkat, Antibody Dilution: 1.0 ug/ml. RPS14 is supported by BioGPS gene expression data to be expressed in Jurkat.
Sample Type: MCF7, Antibody Dilution: 1.0 ug/ml. RPS14 is supported by BioGPS gene expression data to be expressed in MCF7.
WB Suggested Anti-RPS14 Antibody Titration: 2.5 ug/ml, ELISA Titer: 1:12500, Positive Control: HepG2 cell lysate.
IF, IH, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IF, IHC, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Drosophila, Hamster, Mouse, Rabbit, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish | |
Rabbit | |
Polyclonal | |
HRP |