Cart summary

You have no items in your shopping cart.

RNPEPL1 Rabbit Polyclonal Antibody (Biotin)

RNPEPL1 Rabbit Polyclonal Antibody (Biotin)

Catalog Number: orb2102101

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2102101
CategoryAntibodies
DescriptionRNPEPL1 Rabbit Polyclonal Antibody (Biotin)
Species/HostRabbit
ClonalityPolyclonal
Tested applicationsWB
Predicted ReactivityBovine, Canine, Guinea pig, Human, Mouse, Porcine, Rat
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human RNPEPL1
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
ConjugationBiotin
MW55kDa
UniProt IDQ9HAU8
Protein SequenceSynthetic peptide located within the following region: LKPADIGPRSRVWAEPCLLPTATSKLSGAVEQWLSAAERLYGPYMWGRYD
NCBINP_060696
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
Alternative namesFLJ10806, FLJ26675, MGC99544
Read more...
NoteFor research use only
Expiration Date12 months from date of receipt.