Rnls antibody

• Catalog Number: orb331056
• Category: Antibodies
• Description: Rabbit polyclonal antibody to Rnls
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Animal, Canine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat
• Reactivity: Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rat
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 33kDa
• Target: Rnls
• UniProt ID: A7RDN6
• Protein Sequence: Synthetic peptide located within the following region: GMKIGVPWSCRYLSSHPCICFISIDNKKRNIESSECGPSVVIQTTVPFGV
• NCBI: NP_001161290
• Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -2°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti 6530404N21Rik antibody, anti AI452315 antibod
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Western blot analysis of mouse liver tissue lysate tissue using Rnls antibody

Western blot analysis of mouse N2a cell lysate tissue using Rnls antibody

Western blot analysis of mouse Heart tissue using Rnls antibody

Western blot analysis of mouse kidney tissue lysate tissue using Rnls antibody