Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

Rnls Rabbit Polyclonal Antibody

SKU: orb331056

Description

Rabbit polyclonal antibody to Rnls

Research Area

Metabolism Research

Images & Validation

Tested ApplicationsWB
ReactivityHuman, Mouse
Predicted ReactivityCanine, Equine, Guinea pig, Porcine, Rabbit, Rat

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
TargetRnls
Protein SequenceSynthetic peptide located within the following region: GMKIGVPWSCRYLSSHPCICFISIDNKKRNIESSECGPSVVIQTTVPFGV
Molecular Weight33kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

anti 6530404N21Rik antibody, anti AI452315 antibody, anti AW060440 antibody, anti C10orf59 antibody

Similar Products

  • Renalase Rabbit Polyclonal Antibody [orb100619]

    WB

    Canine, Equine, Porcine, Rabbit, Rat

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • RNLS Rabbit Polyclonal Antibody [orb630629]

    ELISA,  IHC,  IP,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μg, 100 μg
  • RNLS/Renalase Rabbit Polyclonal Antibody [orb2950891]

    ELISA,  IHC,  WB

    Mouse

    Rabbit

    Polyclonal

    Unconjugated

    100 μg, 50 μg
  • C10orf59 Rabbit Polyclonal Antibody [orb1175718]

    ELISA,  IHC,  WB

    Mouse, Rat

    Human

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
  • RNLS Antibody [orb1276519]

    IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Rnls Rabbit Polyclonal Antibody

Sample Tissue: Human Fetal Brain, Antibody dilution: 1.0 ug/ml.

Rnls Rabbit Polyclonal Antibody

WB Suggested Anti-Rnls Antibody, Positive Control: Lane 1: 40 ug Mouse kidney tissue lysate, Lane 2: 40 ug Mouse kidney tissue lysate, Primary Antibody Dilution: 1:500, Secondary Antibody: Anti-rabbit-HRP, Secondry Antibody Dilution: 1:2500.

Rnls Rabbit Polyclonal Antibody

WB Suggested Anti-Rnls Antibody, Positive Control: Lane 1: 40 ug Mouse liver tissue lysate, Lane 2: 40 ug Mouse liver tissue lysate, Primary Antibody Dilution: 1:500, Secondary Antibody: Anti-rabbit-HRP, Secondry Antibody Dilution: 1:2500.

Rnls Rabbit Polyclonal Antibody

WB Suggested Anti-Rnls Antibody, Positive Control: Lane 1: 40 ug Mouse N2a cell lysate, Lane 2: 40 ug Mouse N2a cell lysate, Primary Antibody Dilution: 1:500, Secondary Antibody: Anti-rabbit-HRP, Secondry Antibody Dilution: 1:2500.

Rnls Rabbit Polyclonal Antibody

WB Suggested Anti-Rnls Antibody, Titration: 1.0 ug/ml, Positive Control: Mouse Heart.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

Rnls Rabbit Polyclonal Antibody (orb331056)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 600.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 1 - 2 weeks
Bulk Enquiry