You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb331056 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to Rnls |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Canine, Equine, Guinea pig, Porcine, Rabbit, Rat |
Reactivity | Human, Mouse |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 33kDa |
Target | Rnls |
UniProt ID | A7RDN6 |
Protein Sequence | Synthetic peptide located within the following region: GMKIGVPWSCRYLSSHPCICFISIDNKKRNIESSECGPSVVIQTTVPFGV |
NCBI | NP_001161290 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | anti 6530404N21Rik antibody, anti AI452315 antibod Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Sample Tissue: Human Fetal Brain, Antibody dilution: 1.0 ug/ml.
WB Suggested Anti-Rnls Antibody, Positive Control: Lane 1: 40 ug Mouse kidney tissue lysate, Lane 2: 40 ug Mouse kidney tissue lysate, Primary Antibody Dilution: 1:500, Secondary Antibody: Anti-rabbit-HRP, Secondry Antibody Dilution: 1:2500.
WB Suggested Anti-Rnls Antibody, Positive Control: Lane 1: 40 ug Mouse liver tissue lysate, Lane 2: 40 ug Mouse liver tissue lysate, Primary Antibody Dilution: 1:500, Secondary Antibody: Anti-rabbit-HRP, Secondry Antibody Dilution: 1:2500.
WB Suggested Anti-Rnls Antibody, Positive Control: Lane 1: 40 ug Mouse N2a cell lysate, Lane 2: 40 ug Mouse N2a cell lysate, Primary Antibody Dilution: 1:500, Secondary Antibody: Anti-rabbit-HRP, Secondry Antibody Dilution: 1:2500.
WB Suggested Anti-Rnls Antibody, Titration: 1.0 ug/ml, Positive Control: Mouse Heart.
WB | |
Canine, Equine, Porcine, Rabbit, Rat | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IHC, IP, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat | |
Rabbit | |
Polyclonal | |
HRP |
WB | |
Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat | |
Rabbit | |
Polyclonal | |
FITC |
WB | |
Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat | |
Rabbit | |
Polyclonal | |
Biotin |