RNF6 Rabbit Polyclonal Antibody

• Catalog Number: orb576297
• Category: Antibodies
• Description: Rabbit polyclonal antibody to RNF6
• Target: RNF6
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Mouse
• Predicted Reactivity: Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 1.0 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of mouse RNF6
• Protein Sequence: Synthetic peptide located within the following region: MDPSRSRSGGSGEESSFQENERRWQQERLHREEAYYQFINELSDEDYRLM
• UniProt ID: Q9DBU5
• MW: 73kDa
• Tested applications: IHC, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: AA537053, 1200013I08Rik, 5730419H05Rik
• Note: For research use only
• NCBI: NP_083050

Mouse intestine

Mouse Pancreas

WB Suggested Anti-RNF6 Antibody Titration: 1.25 ug/ml, Positive Control: SP2/0 cell lysate.