RNF6 Rabbit Polyclonal Antibody

SKU: orb576297

Description

Rabbit polyclonal antibody to RNF6

Research Area

Epigenetics & Chromatin, Stem Cell & Developmental Biology

Images & Validation

• Tested Applications: IHC, WB
• Reactivity: Mouse
• Predicted Reactivity: Rat

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of mouse RNF6
• Target: RNF6
• Protein Sequence: Synthetic peptide located within the following region: MDPSRSRSGGSGEESSFQENERRWQQERLHREEAYYQFINELSDEDYRLM
• Molecular Weight: 73kDa
• Purification: Protein A purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 1.0 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

AA537053, 1200013I08Rik, 5730419H05Rik

Mouse intestine

Mouse Pancreas

WB Suggested Anti-RNF6 Antibody Titration: 1.25 ug/ml, Positive Control: SP2/0 cell lysate.

Quick Database Links

Gene Symbol

RNF6

UniProt

Q9DBU5

RefSeq (Protein):NP_083050