You have no items in your shopping cart.
Cart summary
Item 1 of 2
Item 1 of 2
RNF213 Rabbit Polyclonal Antibody
Catalog Number: orb580163
| Catalog Number | orb580163 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to RNF213 |
| Species/Host | Rabbit |
| Clonality | Polyclonal |
| Tested applications | IHC, WB |
| Predicted Reactivity | Human |
| Reactivity | Human |
| Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of Human RNF213 |
| Concentration | 0.5 mg/ml |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Conjugation | Unconjugated |
| MW | 118kDa |
| Target | RNF213 |
| UniProt ID | Q63HN8 |
| Protein Sequence | Synthetic peptide located within the following region: ETGNNSVQTVFQGTLAATKRWLREVFTKNMLTSSGASFTYVKEIEVWRRL |
| NCBI | NP_066005 |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Alternative names | ALO17, MYMY2, MYSTR, NET57, C17orf27, KIAA1618 Read more... |
| Note | For research use only |
| Expiration Date | 12 months from date of receipt. |
Sample Type: Thyroid Tumor lysates, Antibody dilution: 1.0 ug/ml.
Rabbit Anti-RNF213 antibody, Formalin Fixed Paraffin Embedded Tissue: Human Colon, Primary antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20x, Exposure Time: 0.5-2.0 sec.
- Item 1 of 3
RNF213 Rabbit Polyclonal Antibody [orb2806]
IF, IHC-Fr, IHC-P
Bovine, Equine, Human, Porcine, Sheep
Mouse, Rat
Rabbit
Polyclonal
Unconjugated
50 μl, 100 μl, 200 μl - Item 1 of 1
