You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb330303 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to RNF212 |
Target | RNF212 |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Canine, Mouse, Rabbit |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human RNF212 |
Protein Sequence | Synthetic peptide located within the following region: LCKKYSRETSQILEFQEKHRKRLLAFYREKISRLEESLRKSVLQIEQLQS |
UniProt ID | Q495C1 |
MW | 26kDa |
Tested applications | WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | anti FLJ38841 antibody, anti MGC120227 antibody, a Read more... |
Note | For research use only |
NCBI | NP_919420 |
WB Suggested Anti-RNF212 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:12500, Positive Control: HepG2 cell lysate.
WB | |
Canine, Human, Mouse, Rabbit | |
Rabbit | |
Polyclonal | |
HRP |
WB | |
Canine, Human, Mouse, Rabbit | |
Rabbit | |
Polyclonal | |
FITC |
WB | |
Canine, Human, Mouse, Rabbit | |
Rabbit | |
Polyclonal | |
Biotin |
ELISA, ICC, IF, IHC-Fr, IHC-P | |
Rabbit | |
Polyclonal | |
Unconjugated |