You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb587739 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to RNF19B |
Target | RNF19B |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Equine, Mouse, Porcine, Rabbit, Rat |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of Human RNF19B |
Protein Sequence | Synthetic peptide located within the following region: VHAQMAENEEEGSGGGGSEEDPPCRHQSCEQKDCLASKPWDISLAQPESI |
UniProt ID | Q6ZMZ0 |
MW | 80kDa |
Tested applications | WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | NKLAM, IBRDC3 |
Note | For research use only |
Sample Type: 721_B Whole cell lysates, Antibody Dilution: 1.0 ug/ml.
WB | |
Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, IHC-Fr, IHC-P | |
Bovine, Canine, Gallus, Mouse, Porcine, Rabbit, Rat, Sheep | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IHC, WB | |
Mouse, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |