You have no items in your shopping cart.
Rnf122 Rabbit Polyclonal Antibody
Description
Research Area
Images & Validation
−| Tested Applications | WB |
|---|---|
| Reactivity | Mouse |
| Predicted Reactivity | Bovine, Canine, Equine, Goat, Guinea pig, Human, Porcine, Rabbit, Rat, Zebrafish |
Key Properties
−| Host | Rabbit |
|---|---|
| Clonality | Polyclonal |
| Immunogen | The immunogen is a synthetic peptide corresponding to a region of Mouse |
| Target | Rnf122 |
| Protein Sequence | Synthetic peptide located within the following region: SLIFCCYFISKLRNQAQSERYGYKEVVLKGDAKKLQLYGTCAVCLEDFKG |
| Molecular Weight | 17kDa |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−RNF122 Rabbit Polyclonal Antibody [orb101563]
WB
Bovine, Canine, Equine, Mouse, Porcine, Rabbit
Human, Rat
Rabbit
Polyclonal
Unconjugated
50 μl, 100 μl, 200 μlRnf122 Rabbit Polyclonal Antibody (HRP) [orb2120879]
WB
Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish
Rabbit
Polyclonal
HRP
100 μlRnf122 Rabbit Polyclonal Antibody (FITC) [orb2120880]
WB
Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish
Rabbit
Polyclonal
FITC
100 μl

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

WB Suggested Anti-Rnf122 Antibody, Titration: 1.0 ug/ml, Positive Control: Mouse Heart.
Documents Download
Request a Document
Rnf122 Rabbit Polyclonal Antibody (orb578788)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review

