You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb576873 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to RNF113A |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Canine, Equine, Porcine |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human RNF113A |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 39 kDa |
Target | RNF113A |
UniProt ID | O15541 |
Protein Sequence | Synthetic peptide located within the following region: LQHFRTTPRCYVCDQQTNGVFNPAKELIAKLEKHRATGEGGASDLPEDPD |
NCBI | NP_008909 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | TTD5, Cwc24, RNF113, ZNF183 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment.
WB Suggested Anti-RNF113A Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: Transfected 293T.
IF, IHC-Fr, IHC-P, WB | |
Bovine, Canine, Equine, Gallus, Human, Porcine, Rabbit, Sheep | |
Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Canine, Equine, Mouse, Porcine, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Canine, Equine, Human, Porcine | |
Rabbit | |
Polyclonal | |
HRP |
WB | |
Canine, Equine, Human, Porcine | |
Rabbit | |
Polyclonal | |
FITC |
WB | |
Canine, Equine, Human, Porcine | |
Rabbit | |
Polyclonal | |
Biotin |