You have no items in your shopping cart.
Cart summary
Item 1 of 1
RLN2 antibody
Catalog Number: orb326489
| Catalog Number | orb326489 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to RLN2 |
| Species/Host | Rabbit |
| Clonality | Polyclonal |
| Tested applications | WB |
| Predicted Reactivity | Human |
| Reactivity | Human |
| Concentration | 0.5 mg/ml |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Conjugation | Unconjugated |
| MW | 21kDa |
| Target | RLN2 |
| UniProt ID | P04090 |
| Protein Sequence | Synthetic peptide located within the following region: PQLQQHVPVLKDSSLLFEEFKKLIRNRQSEAADSSPSELKYLGLDTHSRK |
| NCBI | NP_604390 |
| Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -2°C in small aliquots to prevent freeze-thaw cycles. |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Alternative names | anti H2 antibody, anti RLXH2 antibody, anti bA12D2 Read more... |
| Note | For research use only |
| Expiration Date | 12 months from date of receipt. |
Western blot analysis of Hela Whole Cell tissue using RLN2 antibody
- Item 1 of 2
- Item 1 of 2
- Item 1 of 2
- Item 1 of 2
RLN2 Antibody [orb1564326]
IHC-P, WB
Human, Mouse, Rat
Rabbit
Monoclonal
Unconjugated
100 μl, 50 μl, 20 μl - Item 1 of 1
Submit a review
Filter by Rating
- 5 stars
- 4 stars
- 3 stars
- 2 stars
- 1 stars