RIPK3 Rabbit Polyclonal Antibody

• Catalog Number: orb592648
• Category: Antibodies
• Description: Rabbit polyclonal antibody to RIPK3
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Canine, Equine
• Reactivity: Human, Rat
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RIPK3
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 52 kDa
• Target: RIPK3
• UniProt ID: Q9Y572
• Protein Sequence: Synthetic peptide located within the following region: ETPGLEGLKELMQLCWSSEPKDRPSFQECLPKTDEVFQMVENNMNAAVST
• NCBI: NP_006862
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: RIP3
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

25 ug of the indicated Mouse or Rat tissue extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment. Protein may be phosporylated, and the peptide has 92% identity for the rat Ripk3 sequence.

Sample Tissue: Rat Brain, Antibody Dilution: 1 ug/ml.

Spleen

WB Suggested Anti-RIPK3 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: PANC1 cell lysate.