RIPK1 Rabbit Polyclonal Antibody

• Catalog Number: orb592671
• Category: Antibodies
• Description: Rabbit polyclonal antibody to RIPK1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RIPK1
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 76kDa
• Target: RIPK1
• UniProt ID: Q13546
• Protein Sequence: Synthetic peptide located within the following region: RRRRVSHDPFAQQRPYENFQNTEGKGTAYSSAASHGNAVHQPSGLTSQPQ
• NCBI: NP_003795
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: RIP, RIP1, AIEFL, IMD57, RIP-1
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Lanes: Lane 1: 10 ug 293(Trex)FlpIn-RIPK1-HA-Strep (-Doxycycline)-non induced, Lane 2: 10 ug 293(Trex)FlpIn-RIPK1-HA-Strep (+Doxycycline)-induced, Primary Antibody Dilution: 1:1000, Secondary Antibody: Anti-rabbit HRP, Secondary Antibody Dilution: 1:2000, Gene Name: RIPK1.

WB Suggested Anti-RIPK1 Antibody Titration: 0.2-1 ug/ml, Positive Control: HepG2 cell lysate.