RIPK1 Rabbit Polyclonal Antibody

SKU: orb592671

Description

Rabbit polyclonal antibody to RIPK1

Research Area

Cell Biology, Epigenetics & Chromatin, Immunology & Inflammation, Infectious Disease & Virology, Signal Transduction

Images & Validation

• Tested Applications: WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RIPK1
• Target: RIPK1
• Protein Sequence: Synthetic peptide located within the following region: RRRRVSHDPFAQQRPYENFQNTEGKGTAYSSAASHGNAVHQPSGLTSQPQ
• Molecular Weight: 76kDa
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

RIP, RIP1, AIEFL, IMD57, RIP-1

Lanes: Lane 1: 10 ug 293(Trex)FlpIn-RIPK1-HA-Strep (-Doxycycline)-non induced, Lane 2: 10 ug 293(Trex)FlpIn-RIPK1-HA-Strep (+Doxycycline)-induced, Primary Antibody Dilution: 1:1000, Secondary Antibody: Anti-rabbit HRP, Secondary Antibody Dilution: 1:2000, Gene Name: RIPK1.

WB Suggested Anti-RIPK1 Antibody Titration: 0.2-1 ug/ml, Positive Control: HepG2 cell lysate.

Quick Database Links

Gene Symbol

RIPK1

UniProt

Q13546

RefSeq (Protein):NP_003795