RINL Rabbit Polyclonal Antibody

SKU: orb586731

Description

Rabbit polyclonal antibody to RINL

Images & Validation

• Tested Applications: IP, WB
• Reactivity: Human
• Predicted Reactivity: Human

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human RINL
• Target: RINL
• Protein Sequence: Synthetic peptide located within the following region: ETHRGWGREQTPQETEPEAAQRHDPAPRNPAPHGVSWVKGPLSPEVDHPG
• Molecular Weight: 50kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

FLJ44131, FLJ45909

Amount and Sample Type: GFP-hRinl transfected COS7 cell lysate, Amount of IP Antibody: 10 ug, Primary Antibody: anti-GFP, Primary Antibody dilution: 1:1000, Secondary Antibody: Goat anti-rabbit-HRP, Secondary Antibody dilution: 1:5000, Gene Name: RINL.

Lanes: Lane 1: Jurkat lysate, Lane 2: HeLa lysate, Lane 3: GFP-Rinl transfected COS7 lysate, Primary Antibody dilution: 1:1000, Secondary Antibody: Goat anti-rabbit-HRP, Secondary Antibody dilution: 1:5000, Gene Name: RINL.

WB Suggested Anti-RINL Antibody, Titration: 1.0 ug/ml, Positive Control: HepG2 Whole Cell.

Quick Database Links

Gene Symbol

RINL

UniProt

Q6ZS11

RefSeq (Protein):NP_940847