You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb586731 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to RINL |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IP, WB |
Predicted Reactivity | Human |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of Human RINL |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 50kDa |
Target | RINL |
UniProt ID | Q6ZS11 |
Protein Sequence | Synthetic peptide located within the following region: ETHRGWGREQTPQETEPEAAQRHDPAPRNPAPHGVSWVKGPLSPEVDHPG |
NCBI | NP_940847 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | FLJ44131, FLJ45909 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Amount and Sample Type: GFP-hRinl transfected COS7 cell lysate, Amount of IP Antibody: 10 ug, Primary Antibody: anti-GFP, Primary Antibody dilution: 1:1000, Secondary Antibody: Goat anti-rabbit-HRP, Secondary Antibody dilution: 1:5000, Gene Name: RINL.
Lanes: Lane 1: Jurkat lysate, Lane 2: HeLa lysate, Lane 3: GFP-Rinl transfected COS7 lysate, Primary Antibody dilution: 1:1000, Secondary Antibody: Goat anti-rabbit-HRP, Secondary Antibody dilution: 1:5000, Gene Name: RINL.
WB Suggested Anti-RINL Antibody, Titration: 1.0 ug/ml, Positive Control: HepG2 Whole Cell.