You have no items in your shopping cart.
Cart summary
Item 1 of 3
Item 1 of 3
RINL Rabbit Polyclonal Antibody
Catalog Number: orb586731
| Catalog Number | orb586731 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to RINL |
| Species/Host | Rabbit |
| Clonality | Polyclonal |
| Tested applications | IP, WB |
| Predicted Reactivity | Human |
| Reactivity | Human |
| Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of Human RINL |
| Concentration | 0.5 mg/ml |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Conjugation | Unconjugated |
| MW | 50kDa |
| Target | RINL |
| UniProt ID | Q6ZS11 |
| Protein Sequence | Synthetic peptide located within the following region: ETHRGWGREQTPQETEPEAAQRHDPAPRNPAPHGVSWVKGPLSPEVDHPG |
| NCBI | NP_940847 |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Alternative names | FLJ44131, FLJ45909 Read more... |
| Note | For research use only |
| Expiration Date | 12 months from date of receipt. |
Amount and Sample Type: GFP-hRinl transfected COS7 cell lysate, Amount of IP Antibody: 10 ug, Primary Antibody: anti-GFP, Primary Antibody dilution: 1:1000, Secondary Antibody: Goat anti-rabbit-HRP, Secondary Antibody dilution: 1:5000, Gene Name: RINL.
Lanes: Lane 1: Jurkat lysate, Lane 2: HeLa lysate, Lane 3: GFP-Rinl transfected COS7 lysate, Primary Antibody dilution: 1:1000, Secondary Antibody: Goat anti-rabbit-HRP, Secondary Antibody dilution: 1:5000, Gene Name: RINL.
WB Suggested Anti-RINL Antibody, Titration: 1.0 ug/ml, Positive Control: HepG2 Whole Cell.
- Item 1 of 2
- Item 1 of 2
