RIMS3 Rabbit Polyclonal Antibody

• Catalog Number: orb575233
• Category: Antibodies
• Description: Rabbit polyclonal antibody to RIMS3
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Zebrafish
• Reactivity: Human, Mouse
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human RIMS3
• Concentration: 1.0 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 33kDa
• Target: RIMS3
• UniProt ID: Q9UJD0
• Protein Sequence: Synthetic peptide located within the following region: IMLDELDLSAAVTGWYKLFPTSSVADSTLGSLTRRLSQSSLESATSPSCS
• NCBI: NP_055562
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: NIM3, RIM3, RIM 3
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Tissue: Mouse Pancreas, Antibody dilution: 1 ug/ml.

Human kidney

WB Suggested Anti-RIMS3 Antibody Titration: 1.25 ug/ml, ELISA Titer: 1:312500, Positive Control: Jurkat cell lysate, RIMS3 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells.