You have no items in your shopping cart.
Cart summary
Item 1 of 1
Rhox8 Rabbit Polyclonal Antibody
Catalog Number: orb324664
| Catalog Number | orb324664 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to Rhox8 |
| Target | Rhox8 |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Mouse |
| Predicted Reactivity | Rat |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse Rhox8 |
| Protein Sequence | Synthetic peptide located within the following region: RISRSRSTVNSIHAMEPQEVTQSSLLRDDEIKESDDAAAWIVSQEMKERE |
| UniProt ID | Q6VSS7 |
| MW | 36kDa |
| Tested applications | WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Alternative names | anti Tox antibody |
| Note | For research use only |
| NCBI | NP_001004193 |
Sample Type: Mouse Testis lysates, Antibody Dilution: 1.0 ug/mL.
- Item 1 of 1
- Item 1 of 1
