You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb324664 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to Rhox8 |
Target | Rhox8 |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Mouse |
Predicted Reactivity | Rat |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse Rhox8 |
Protein Sequence | Synthetic peptide located within the following region: RISRSRSTVNSIHAMEPQEVTQSSLLRDDEIKESDDAAAWIVSQEMKERE |
UniProt ID | Q6VSS7 |
MW | 36kDa |
Tested applications | WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | anti Tox antibody |
Note | For research use only |
NCBI | NP_001004193 |
Sample Type: Mouse Testis lysates, Antibody Dilution: 1.0 ug/mL.