You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb577984 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to RHOU |
Target | RHOU |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human RHOU |
Protein Sequence | Synthetic peptide located within the following region: LKEVFDAAIVAGIQYSDTQQQPKKSKSRTPDKMKNLSKSWWKKYCCFV |
UniProt ID | Q7L0Q8 |
MW | 28kDa |
Tested applications | WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | ARHU, G28K, WRCH1, hG28K, CDC42L1 |
Note | For research use only |
NCBI | NP_067028 |
Positive control (+): Hela (HL), Negative control (-): Human lung (LU), Antibody concentration: 1 ug/ml.
WB Suggested Anti-RHOU Antibody Titration: 0.2-1 ug/ml, Positive Control: Human Muscle.
IF, IHC-Fr, IHC-P, WB | |
Bovine, Human, Rabbit | |
Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, IHC-Fr, IHC-P, WB | |
Bovine, Human, Rabbit | |
Mouse, Rat | |
Rabbit | |
Polyclonal | |
Biotin |
WB | |
Bovine, Canine, Equine, Human, Porcine, Rabbit, Rat, Zebrafish | |
Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, WB | |
Mouse, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |