RHOU Rabbit Polyclonal Antibody

• Catalog Number: orb577984
• Category: Antibodies
• Description: Rabbit polyclonal antibody to RHOU
• Target: RHOU
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human RHOU
• Protein Sequence: Synthetic peptide located within the following region: LKEVFDAAIVAGIQYSDTQQQPKKSKSRTPDKMKNLSKSWWKKYCCFV
• UniProt ID: Q7L0Q8
• MW: 28kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: ARHU, G28K, WRCH1, hG28K, CDC42L1
• Note: For research use only
• NCBI: NP_067028

Positive control (+): Hela (HL), Negative control (-): Human lung (LU), Antibody concentration: 1 ug/ml.

WB Suggested Anti-RHOU Antibody Titration: 0.2-1 ug/ml, Positive Control: Human Muscle.