RGS16 Rabbit Polyclonal Antibody

• Catalog Number: orb574910
• Category: Antibodies
• Description: Rabbit polyclonal antibody to RGS16
• Target: RGS16
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Mouse, Porcine, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 1.0 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Protein A purified
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human RGS16
• Protein Sequence: Synthetic peptide located within the following region: DAAQGKTRTLMEKDSYPRFLKSPAYRDLAAQASAASATLSSCSLDEPSHT
• UniProt ID: Q5VYN9
• MW: 23kDa
• Tested applications: IF, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: RGS-R, A28-RGS14, A28-RGS14P
• Research Area: Pharmacology & Drug Discovery
• Note: For research use only
• NCBI: NP_002919

Positive control (+): Human Liver (LI), Negative control (-): HepG2 Cell Lysate (HG), Antibody concentration: 0.5 ug/ml.

WB Suggested Anti-RGS16 Antibody Titration: 1.0 ug/ml, Positive Control: Jurkat cell lysate.