RGS10 Rabbit Polyclonal Antibody

• Catalog Number: orb331569
• Category: Antibodies
• Description: Rabbit polyclonal antibody to RGS10
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: FACS, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Rabbit, Rat
• Reactivity: Human, Mouse
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RGS10
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 21kDa
• Target: RGS10
• UniProt ID: Q96GN0
• Protein Sequence: Synthetic peptide located within the following region: DQIFNLMKYDSYSRFLKSDLFLKHKRTEEEEEDLPDAQTAAKRASRIYNT
• NCBI: NP_001005339
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

bone marrow derived monocytes.

WB Suggested Anti-RGS10 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: Jurkat cell lysate, There is BioGPS gene expression data showing that RGS10 is expressed in Jurkat.