Cart summary

You have no items in your shopping cart.

RGD1563533 Rabbit Polyclonal Antibody (FITC)

RGD1563533 Rabbit Polyclonal Antibody (FITC)

Catalog Number: orb2127651

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2127651
CategoryAntibodies
DescriptionRGD1563533 Rabbit Polyclonal Antibody (FITC)
ClonalityPolyclonal
Species/HostRabbit
ConjugationFITC
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
Protein SequenceSynthetic peptide located within the following region: PQMPQIPSSVPHLPTSPLATTSLESAKPQVKPGFLQFQDNDPCLATDCKY
MW196kDa
Tested applicationsWB
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Alternative namesRGD1563533
NoteFor research use only
NCBIXP_002726704