REST Rabbit Polyclonal Antibody

• Catalog Number: orb574228
• Category: Antibodies
• Description: Rabbit polyclonal antibody to REST
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human REST
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 122kDa
• Target: REST
• UniProt ID: Q13127
• Protein Sequence: Synthetic peptide located within the following region: PMLPPSAVEEREAVSKTALASPPATMAANESQEIDEDEGIHSHEGSDLSD
• NCBI: NP_005603
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: WT6, XBR, HGF5, NRSF, DFNA27, GINGF5
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Tissue: Human MCF7, Antibody dilution: 1.0 ug/ml.

Sample Type: Human Fetal Liver, Antibody dilution: 1.0 ug/ml.

Sample Type: MCF7, Antibody dilution: 1.0 ug/ml. REST is supported by BioGPS gene expression data to be expressed in MCF7.

REST antibody - middle region (orb574228) validated by WB using A549 and HEK293T cells at 1: 500.

WB Suggested Anti-REST Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: MCF7 cell lysate, REST is supported by BioGPS gene expression data to be expressed in MCF7.