You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb574228 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to REST |
Target | REST |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human REST |
Protein Sequence | Synthetic peptide located within the following region: PMLPPSAVEEREAVSKTALASPPATMAANESQEIDEDEGIHSHEGSDLSD |
UniProt ID | Q13127 |
MW | 122kDa |
Tested applications | WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | WT6, XBR, HGF5, NRSF, DFNA27, GINGF5 |
Note | For research use only |
NCBI | NP_005603 |
Sample Tissue: Human MCF7, Antibody dilution: 1.0 ug/ml.
Sample Type: Human Fetal Liver, Antibody dilution: 1.0 ug/ml.
Sample Type: MCF7, Antibody dilution: 1.0 ug/ml. REST is supported by BioGPS gene expression data to be expressed in MCF7.
REST antibody - middle region (orb574228) validated by WB using A549 and HEK293T cells at 1: 500.
WB Suggested Anti-REST Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: MCF7 cell lysate, REST is supported by BioGPS gene expression data to be expressed in MCF7.
WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |