You have no items in your shopping cart.
You have no items in your shopping cart.
| Catalog Number | orb589140 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to RELL2 |
| Target | RELL2 |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Human |
| Predicted Reactivity | Human |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Affinity purified |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human RELL2 |
| Protein Sequence | Synthetic peptide located within the following region: RYGLHEHRDGSPTDRSWGSGGGQDPGGGQGSGGGQPKAGMPAMERLPPER |
| UniProt ID | Q8NC24 |
| MW | 33 kDa |
| Tested applications | WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Alternative names | C5orf16 |
| Research Area | Cell Biology |
| Note | For research use only |
| NCBI | NP_001123501.1 |

Sample Tissue: Human 721_B lymphoblast Whole Cell lysates, Antibody Dilution: 1 ug/ml.
IF, IHC-Fr, IHC-P | |
Bovine, Canine, Equine, Human, Porcine, Rabbit, Rat, Sheep | |
Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF | |
Bovine, Canine, Equine, Human, Porcine, Rabbit, Rat, Sheep | |
Mouse | |
Rabbit | |
Polyclonal | |
Cy5 |
IF | |
Bovine, Canine, Equine, Human, Porcine, Rabbit, Rat, Sheep | |
Mouse | |
Rabbit | |
Polyclonal | |
PE/Cy5.5 |
IF | |
Bovine, Canine, Equine, Human, Porcine, Rabbit, Rat, Sheep | |
Mouse | |
Rabbit | |
Polyclonal | |
PE/Cy7 |
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review