You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb330318 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to RELB |
Target | RELB |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Mouse |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Human, Rabbit, Rat |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 1.0 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human RELB |
Protein Sequence | Synthetic peptide located within the following region: GPEPLTLDSYQAPGPGDGGTASLVGSNMFPNHYREAAFGGGLLSPGPEAT |
UniProt ID | Q01201 |
MW | 62kDa |
Tested applications | WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | anti I-REL antibody, anti IREL antibody, anti REL- Read more... |
Note | For research use only |
NCBI | NP_006500 |
Sample Tissue: Mouse Pancreas, Antibody Dilution: 1 ug/mL.
Sample Tissue: Mouse Pancreas, Antibody Dilution: 1 ug/mL.
WB Suggested Anti-RELB Antibody Titration: 1.25 ug/mL, Positive Control: Transfected 293T.
IF, IHC-Fr, IHC-P, WB | |
Rabbit | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
FC, IF, IHC-Fr, IHC-P, WB | |
Bovine, Canine, Equine, Porcine, Rat | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Canine, Human, Rat | |
Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
IH, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |