RELA Rabbit Polyclonal Antibody

• Catalog Number: orb573634
• Category: Antibodies
• Description: Rabbit polyclonal antibody to NFkB p65
• Target: RELA
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human, Mouse
• Predicted Reactivity: Bovine, Canine, Porcine, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RELA
• Protein Sequence: Synthetic peptide located within the following region: LVTGAQRPPDPAPAPLGAPGLPNGLLSGDEDFSSIADMDFSALLSQISS
• UniProt ID: Q04206
• MW: 60kDa
• Tested applications: IHC, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: p65, CMCU, NFKB3
• Note: For research use only
• NCBI: NP_068810

Sample Tissue: Mouse Liver, Antibody dilution: 1 ug/ml.

Sample Tissue: Mouse Liver, Antibody dilution: 1 ug/ml.

Sample Type: Human Adult Placenta, Antibody dilution: 1.0 ug/ml.

Sample Type: Human Adult Placenta, Antibody dilution: 1.0 ug/ml.

Sample Type: Human Fetal Heart, Antibody dilution: 1.0 ug/ml.

Sample Type: Human Fetal Lung, Antibody dilution: 1.0 ug/ml.

Sample Type: Human Hela, Antibody dilution: 1.0 ug/ml. RELA is supported by BioGPS gene expression data to be expressed in HeLa.

Rabbit Anti-RELA Antibody, Catalog Number: orb573634, Formalin Fixed Paraffin Embedded Tissue: Human Liver Tissue, Observed Staining: Cytoplasm in hepatocytes, Primary Antibody Concentration: 1:100, Other Working Concentrations: N/A, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

WB Suggested Anti-RELA Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: Transfected 293T.