Cart summary

You have no items in your shopping cart.

REEP3 Rabbit Polyclonal Antibody (Biotin)

REEP3 Rabbit Polyclonal Antibody (Biotin)

Catalog Number: orb2089870

Select Product Size
SizePriceQuantity
100 μl$ 0.00
100 μl Enquire
DispatchUsually dispatched within 5-10 working days
Product Properties
Catalog Numberorb2089870
CategoryAntibodies
DescriptionREEP3 Rabbit Polyclonal Antibody (Biotin)
ClonalityPolyclonal
Species/HostRabbit
ConjugationBiotin
Predicted ReactivityEquine, Guinea pig, Human, Porcine, Rabbit, Rat
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
PurificationAffinity Purified
ImmunogenThe immunogen is a synthetic peptide directed towards the C-terminal region of Human REEP3
Protein SequenceSynthetic peptide located within the following region: HDLTTIQGDEPVGQRPYQPLPEAKKKSKPAPSESAGYGIPLKDGDEKTDE
UniProt IDQ6NUK4
MW28kDa
Tested applicationsWB
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Alternative namesYip2b, C10orf74
NoteFor research use only
NCBINP_001001330
Images
Reviews

REEP3 Rabbit Polyclonal Antibody (Biotin) (orb2089870)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet