You have no items in your shopping cart.
Cart summary
Recombinant Rat APRIL
Catalog Number: orb623200
| Catalog Number | orb623200 |
|---|---|
| Category | Proteins |
| Description | A proliferation-inducing ligand (APRIL), also known as TNFSF13, is a member of the tumor necrosis factor (TNF) ligand superfamily. APRIL/TNFSF13 has been shown to play a role in protecting cells from undergoing apoptosis and promoting B cell development. Rat APRIL Recombinant Protein is purified APRIL (TNFSF13) produced in yeast. |
| Form/Appearance | Lyophilized |
| MW | 16.4 kDa |
| Protein Sequence | AVLTQKHKKKQSVLHLVPINITSKADSDMTEVMWQPALRRGRGLEAQGDTVRVRDTGIYL LYSQVLFHDVTFTMGQVVSREGQGRRETLFRCIKSMPSDPDRAYNSCYSAGVFHLHQGDI ITVKIPRANAKLSLSPHGTFLGFVKL (146) |
| Source | Yeast |
| Storage | -20°C |
| Note | For research use only |
| Application notes | The Mouse FGF basic protein can be used in cell culture, as a FGF basic ELISA Standard, and as a Western Blot Control. |
| Expiration Date | 6 months from date of receipt. |
