You have no items in your shopping cart.
Cart summary
Rat APRIL protein
Catalog Number: orb1216247
| Catalog Number | orb1216247 |
|---|---|
| Category | Proteins |
| Description | The Rat APRIL yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Rat APRIL applications are for cell culture, ELISA standard, and Western Blot Control. The Rat APRIL yeast-derived recombinant protein can be purchased in multiple sizes. Rat APRIL Specifications: (Molecular Weight: 16.4 kDa) (Amino Acid Sequence: AVLTQKHKKKQSVLHLVPINITSKADSDMTEVMWQPALRRGRGLEAQGDTVRVRDTGIYLLYSQVLFHDVTFTMGQVVSREGQGRRETLFRCIKSMPSDPDRAYNSCYSAGVFHLHQGDIITVKIPRANAKLSLSPHGTFLGFVKL (146)) (Gene ID: 287437). |
| Form/Appearance | Lyophilized |
| Purity | 98% |
| MW | 16.4 kDa |
| Target | APRIL |
| Protein Sequence | AVLTQKHKKKQSVLHLVPINITSKADSDMTEVMWQPALRRGRGLEAQGDTVRVRDTGIYLLYSQVLFHDVTFTMGQVVSREGQGRRETLFRCIKSMPSDPDRAYNSCYSAGVFHLHQGDIITVKIPRANAKLSLSPHGTFLGFVKL (146) |
| Protein Length | 146 |
| Source | Yeast |
| Biological Origin | Rat |
| Storage | -20°C |
| Alternative names | TNFSF13 Read more... |
| Note | For research use only |
| Expiration Date | 6 months from date of receipt. |
