You have no items in your shopping cart.
Recombinant Human Vascular endothelial growth factor A, long form (VEGFA) (Active)
SKU: orb2986476
Active
Description
Research Area
Cardiovascular Research, Neuroscience
Images & Validation
−
| Application Notes |
|---|
Key Properties
−| Source | Mammalian cell |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Biological Activity | ①Measured by its binding ability in a functional ELISA. Immobilized Human VEGFA protein at 2 μg/mL can bind Anti-VEGFA recombinant antibody. The EC50 is 0.6797-0.8382 ng/mL. ②Measured by its binding ability in a functional ELISA. Immobilized Human FLT1 protein at 2 μg/mL can bind Human VEGFA protein. The EC50 is 28.72-33.22 ng/mL. |
| Tag | N-terminal 6xHis-tagged |
| Molecular Weight | 21.4 kDa |
| Expression Region | 27-191aa |
| Protein Length | Full Length of Mature Protein of Isoform VEGF165 |
| Protein Sequence | APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQENPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR |
| Purity | Greater than 95% as determined by SDS-PAGE. |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
|---|---|
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Disclaimer | For research use only |
Alternative Names
−Vascular endothelial growth factor A, long form; L-VEGF; Vascular permeability factor (VPF); VEGFA; VEGF
Similar Products
−Recombinant Human Vascular endothelial growth factor A, long form (VEGFA) (Active) [orb2657906]
Greater than 95% as determined by SDS-PAGE.
20 kDa
Mammalian cell
50 μg, 1 mg, 10 μgRecombinant Human Vascular endothelial growth factor A, long form (VEGFA) (Active) [orb2657907]
Greater than 95% as determined by SDS-PAGE.
19.1 kDa
Mammalian cell
1 mg, 50 μg, 10 μg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
Recombinant Human Vascular endothelial growth factor A, long form (VEGFA) (Active) (orb2986476)
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review