You have no items in your shopping cart.
Recombinant Human Leukemia inhibitory factor (LIF) (Active)
Description
Images & Validation
−
| Application Notes |
|---|
Key Properties
−| Source | Mammalian cell |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Biological Activity | Measured in the M1 cell differentiation assay. The ED50 is ≤0.2ng/ml. |
| Tag | Tag free |
| Molecular Weight | 19.7 kDa |
| Expression Region | 23-202aa |
| Protein Length | Full Length of Mature Protein |
| Protein Sequence | SPLPITPVNATCAIRHPCHNNLMNQIRSQLAQLNGSANALFILYYTAQGEPFPNNLDKLCGPNVTDFPPFHANGTEKAKLVELYRIVVYLGTSLGNITRDQKILNPSALSLHSKLNATADILRGLLSNVLCRLCSKYHVGHVDVTYGPDTSGKDVFQKKKLGCQLLGKYKQIIAVLAQAF |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| Endotoxins | ≤10 EU/mg by the LAL method |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
|---|---|
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized from a 0.2 μm filtered solution containing PBS, 5% mannitoland 0.01% Tween 80, pH 7.4 |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−Recombinant Human Leukemia inhibitory factor (LIF) (Active) [orb1095883]
Greater than 90% as determined by SDS-PAGE.
48.6 kDa
Mammalian cell
1 mg, 20 μg, 100 μgRecombinant Human Leukemia inhibitory factor (LIF) (Active) [orb1785348]
Greater than 95% as determined by SDS-PAGE.
23.1 kDa
Mammalian cell
1 mg, 100 μg, 20 μgRecombinantOSM,Rat [orb1494781]
> 95% as analyzed by SDS-PAGE and HPLC.
24.5 kDa, observed by reducing SDS-PAGE.
Escherichia coli.
10 μg, 50 μg, 1 mgRecombinantOSM,Mouse [orb1494782]
> 95% as analyzed by SDS-PAGE and HPLC.
20.5 kDa, observed by reducing SDS-PAGE.
Escherichia coli.
10 μg, 50 μg, 1 mgRecombinantOSM(209aa),Human [orb1494784]
> 95% as analyzed by SDS-PAGE and HPLC.
23.8 kDa, observed by reducing SDS-PAGE.
Escherichia coli.
10 μg, 50 μg, 1 mg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Quick Database Links
UniProt Details
−Documents Download
Request a Document
Protocol Information
Recombinant Human Leukemia inhibitory factor (LIF) (Active) (orb2657908)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review


