You have no items in your shopping cart.
RCBTB2 Rabbit Polyclonal Antibody
Description
Images & Validation
−| Tested Applications | WB |
|---|---|
| Reactivity | Human |
| Predicted Reactivity | Human |
Key Properties
−| Host | Rabbit |
|---|---|
| Clonality | Polyclonal |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human RCBTB2 |
| Target | RCBTB2 |
| Protein Sequence | Synthetic peptide located within the following region: NSYGQLGTGNKSNQSYPTPVTVEKDRIIEIAACHSTHTSAAKTQGGHVYM |
| Molecular Weight | 60 kDa |
| Purification | Affinity purified |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−RCBTB2 Rabbit Polyclonal Antibody [orb586513]
WB
Bovine, Canine, Equine, Guinea pig, Human, Rabbit, Rat, Zebrafish
Mouse
Rabbit
Polyclonal
Unconjugated
100 μlRCBTB2 Rabbit Polyclonal Antibody (HRP) [orb2090378]
WB
Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish
Rabbit
Polyclonal
HRP
100 μlRCBTB2 Rabbit Polyclonal Antibody (FITC) [orb2090379]
WB
Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish
Rabbit
Polyclonal
FITC
100 μl

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Sample Tissue: Human HT1080 Whole Cell, Antibody Dilution: 1.0 ug/mL.
Quick Database Links
UniProt Details
−NCBI Reference Sequences
−| Protein | NP_001259.1 |
|---|
Documents Download
Request a Document
RCBTB2 Rabbit Polyclonal Antibody (orb327434)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review

![RCBTB2 antibody [N3C3]](/images/pub/media/catalog/product/r/c/rcbtb2-antibody_orb556812_wb_1.jpg)
