You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb331562 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to RBX1 |
Target | RBX1 |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Bovine, Canine, Guinea pig, Mouse, Rat, Zebrafish |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 1.0 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human RBX1 |
Protein Sequence | Synthetic peptide located within the following region: NQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH |
UniProt ID | P62877 |
MW | 12kDa |
Tested applications | WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | anti ROC1 antibody, anti RNF75 antibody, anti BA55 Read more... |
Note | For research use only |
NCBI | NP_055063 |
Sample Type: Human HepG2, Antibody dilution: 1.0 ug/ml.
IF, IHC-P, WB | |
C. elegans | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, IHC-P, WB | |
C. elegans, Mouse | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IHC, IP, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, IHC-Fr, IHC-P | |
Bovine, Rat | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |