RBX1 Rabbit Polyclonal Antibody

• Catalog Number: orb331562
• Category: Antibodies
• Description: Rabbit polyclonal antibody to RBX1
• Target: RBX1
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Guinea pig, Mouse, Rat, Zebrafish
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 1.0 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Protein A purified
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RBX1
• Protein Sequence: Synthetic peptide located within the following region: NQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH
• UniProt ID: P62877
• MW: 12kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: anti ROC1 antibody, anti RNF75 antibody, anti BA55
• Research Area: Cancer Biology, Cell Biology, Molecular Biology, P
• Note: For research use only
• NCBI: NP_055063

Sample Type: Human HepG2, Antibody dilution: 1.0 ug/ml.