RBPMS Rabbit Polyclonal Antibody

• Catalog Number: orb577515
• Category: Antibodies
• Description: Rabbit polyclonal antibody to RBPMS
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: ICC, IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Zebrafish
• Reactivity: Human, Mouse
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human RBPMS
• Concentration: 1.0 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 24kDa
• Target: RBPMS
• UniProt ID: Q93062
• Protein Sequence: Synthetic peptide located within the following region: LFRPFKGYEGSLIKLTSKQPVGFVSFDSRSEAEAAKNALNGIRFDPEIPQ
• NCBI: NP_001008712
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: HERMES
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Mouse Retina Fixation of the tissues with 4% paraformaldehyde in 0.1M PO4, and performed typical procedures of immunocytochemistry. Blocking solution was 0.2% triton X-100 + 5% normal donkey serum in PBS. RBPMS antibody was incubated in blocking solution with 1:200 dilution (4 degree, overnight). Secondary antibody was Cy3-conjugated.

Rabbit Anti-RBPMS Antibody, Paraffin Embedded Tissue: Human Skin, Cellular Data: Squamous epithelial cells, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.

WB Suggested Anti-RBPMS Antibody Titration: 0.5 ug/ml, Positive Control: Human Liver.

WB Suggested Anti-RBPMS Antibody, Titration: 0.5 ug/ml, Positive Control: Liver.