Cart summary

You have no items in your shopping cart.

RBP7 Rabbit Polyclonal Antibody (FITC)

RBP7 Rabbit Polyclonal Antibody (FITC)

Catalog Number: orb2109243

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2109243
CategoryAntibodies
DescriptionRBP7 Rabbit Polyclonal Antibody (FITC)
Species/HostRabbit
ClonalityPolyclonal
Tested applicationsWB
Predicted ReactivityHuman
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human RBP7
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
ConjugationFITC
MW14 kDa
UniProt IDQ96R05
Protein SequenceSynthetic peptide located within the following region: TIHTNSSLRNYFVKFKVGEEFDEDNRGLDNRKCKSLVIWDNDRLTCIQKG
NCBINP_443192
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
Alternative namesCRBP4, CRABP4, CRBPIV
Read more...
NoteFor research use only
Expiration Date12 months from date of receipt.