RBMX Rabbit Polyclonal Antibody

• Catalog Number: orb331148
• Category: Antibodies
• Description: Rabbit polyclonal antibody to RBMX
• Target: RBMX
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Protein Sequence: Synthetic peptide located within the following region: SSSRDGYGGSRDSYSSSRSDLYSSGRDRVGRQERGLPPSMERGYPPPRDS
• UniProt ID: P38159
• MW: 42 kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: anti HNRPG antibody, anti RBMXP1 antibody, anti RB
• Research Area: Cell Biology, Epigenetics & Chromatin, Molecular B
• Note: For research use only
• NCBI: NP_002130

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment.

Sample Type: Hela, Antibody dilution: 1.0 ug/ml. RBMX is supported by BioGPS gene expression data to be expressed in HeLa.

WB Suggested Anti-RBMX Antibody, Titration: 1.0 ug/ml, Positive Control: OVCAR-3 Whole Cell, RBMX is supported by BioGPS gene expression data to be expressed in OVCAR3.