You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb331148 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to RBMX |
Target | RBMX |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Protein Sequence | Synthetic peptide located within the following region: SSSRDGYGGSRDSYSSSRSDLYSSGRDRVGRQERGLPPSMERGYPPPRDS |
UniProt ID | P38159 |
MW | 42 kDa |
Tested applications | WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | anti HNRPG antibody, anti RBMXP1 antibody, anti RB Read more... |
Note | For research use only |
NCBI | NP_002130 |
Expiration Date | 12 months from date of receipt. |
25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment.
Sample Type: Hela, Antibody dilution: 1.0 ug/ml. RBMX is supported by BioGPS gene expression data to be expressed in HeLa.
WB Suggested Anti-RBMX Antibody, Titration: 1.0 ug/ml, Positive Control: OVCAR-3 Whole Cell, RBMX is supported by BioGPS gene expression data to be expressed in OVCAR3.
ELISA, IF, IHC-P, WB | |
Human, Mouse, Rat | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |