RBMX Rabbit Polyclonal Antibody

SKU: orb331148

Description

Rabbit polyclonal antibody to RBMX

Research Area

Cell Biology, Epigenetics & Chromatin, Molecular Biology

Images & Validation

• Tested Applications: WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Target: RBMX
• Protein Sequence: Synthetic peptide located within the following region: SSSRDGYGGSRDSYSSSRSDLYSSGRDRVGRQERGLPPSMERGYPPPRDS
• Molecular Weight: 42 kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

anti HNRPG antibody, anti RBMXP1 antibody, anti RBMXRT antibody, anti RNMX antibody, anti hnRNP-G antibody

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment.

Sample Type: Hela, Antibody dilution: 1.0 ug/ml. RBMX is supported by BioGPS gene expression data to be expressed in HeLa.

WB Suggested Anti-RBMX Antibody, Titration: 1.0 ug/ml, Positive Control: OVCAR-3 Whole Cell, RBMX is supported by BioGPS gene expression data to be expressed in OVCAR3.

Quick Database Links

Gene Symbol

RBMX

UniProt

P38159

RefSeq (Protein):NP_002130