DKFZP564O0523 Rabbit Polyclonal Antibody

SKU: orb324929

Description

Rabbit polyclonal antibody to RBM48

Research Area

Molecular Biology

Images & Validation

• Tested Applications: WB
• Reactivity: Human
• Predicted Reactivity: Canine, Equine, Guinea pig, Mouse, Porcine, Rat, Zebrafish

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human DKFZP564O0523
• Target: RBM48
• Protein Sequence: Synthetic peptide located within the following region: FLQTNPTGNEIMIGPLLPDISKVDMHDDSLNTTANLIRHKLKEVISSVPK
• Molecular Weight: 42kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

anti DKFZp686D1651 antibody, anti HSPC304 antibody, anti C7orf64 antibody, anti DKFZP564O0523 antibody

WB Suggested Anti-DKFZP564O0523 Antibody Titration: 0.2-1 ug/mL, Positive Control: MCF7 cell lysate, There is BioGPS gene expression data showing that RBM48 is expressed in MCF7.

Quick Database Links

Gene Symbol

RBM48

UniProt

Q5RL73

RefSeq (Protein):NP_115496