You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb324929 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to RBM48 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Canine, Equine, Guinea pig, Mouse, Porcine, Rat, Zebrafish |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human DKFZP564O0523 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 42kDa |
Target | RBM48 |
UniProt ID | Q5RL73 |
Protein Sequence | Synthetic peptide located within the following region: FLQTNPTGNEIMIGPLLPDISKVDMHDDSLNTTANLIRHKLKEVISSVPK |
NCBI | NP_115496 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | anti DKFZp686D1651 antibody, anti HSPC304 antibody Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
WB Suggested Anti-DKFZP564O0523 Antibody Titration: 0.2-1 ug/mL, Positive Control: MCF7 cell lysate, There is BioGPS gene expression data showing that RBM48 is expressed in MCF7.
WB | |
Bovine, Canine, Equine, Gallus, Mouse, Rabbit, Rat, Sheep | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rat, Zebrafish | |
Rabbit | |
Polyclonal | |
HRP |
WB | |
Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rat, Zebrafish | |
Rabbit | |
Polyclonal | |
FITC |
WB | |
Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rat, Zebrafish | |
Rabbit | |
Polyclonal | |
Biotin |
WB | |
Bovine, Canine, Equine, Gallus, Mouse, Rabbit, Rat, Sheep | |
Human | |
Rabbit | |
Polyclonal | |
AP |